PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g006980.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 289aa    MW: 33417 Da    PI: 4.6924
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g006980.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.2e-1870123356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++ ++q++ Le+ Fe ++++  e++ +LA++lgL+ rq+ +WFqNrRa++k
  Sopim05g006980.0.1  70 KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLANELGLQPRQIAIWFQNRRARYK 123
                         45578899*********************************************9 PP

2HD-ZIP_I/II124.54.9e-4069160192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl  +qv++LE+sFe ++kLeperKv+la+eLglqprq+a+WFqnrRAR+ktk lEkdy+aLk+++d+lk++ ++L ke+e+Lr+e+
  Sopim05g006980.0.1  69 EKKRRLLPNQVQFLEKSFEVDNKLEPERKVQLANELGLQPRQIAIWFQNRRARYKTKVLEKDYDALKASFDKLKADYDTLFKENEDLRNEV 159
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Sopim05g006980.0.1 160 H 160
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.84E-1857125IPR009057Homeodomain-like
PROSITE profilePS5007117.0765125IPR001356Homeobox domain
SMARTSM003894.2E-1868129IPR001356Homeobox domain
PfamPF000461.9E-1570123IPR001356Homeobox domain
CDDcd000862.39E-1670125No hitNo description
Gene3DG3DSA:1.10.10.602.6E-1873133IPR009057Homeodomain-like
PRINTSPR000311.0E-596105IPR000047Helix-turn-helix motif
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5105121IPR000047Helix-turn-helix motif
PfamPF021836.8E-16125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEVGRVINEK LSHCLWMSNS SPSFHGSVSM VNFEDVGRGE VSKERSFFPG IDKEETSNDD  60
YDSCYHQPEK KRRLLPNQVQ FLEKSFEVDN KLEPERKVQL ANELGLQPRQ IAIWFQNRRA  120
RYKTKVLEKD YDALKASFDK LKADYDTLFK ENEDLRNEVH LLTQKLHIRE KGKENSEQSE  180
PISPIDTQEA QKATTPIVVT SNVPKLMCKQ EDATSAKSDV IDSDSPHYTD GNHSSNVFEQ  240
EPSDFSRDED DNLSKNFLYF PEIGDQIQAN SCNLSFQIED QPCWFWQY*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387470.0AC238747.2 Solanum lycopersicum chromosome 05 clone C05SLe0011J24, complete sequence.
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238764.10.0PREDICTED: homeobox-leucine zipper protein HAT5
TrEMBLK4BWM40.0K4BWM4_SOLLC; Uncharacterized protein
STRINGSolyc05g006980.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-45homeobox 1